быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ENO1 Rabbit mAb (A11448)
- Описание
- Характеристики
-
Overview
Product name ENO1 Rabbit mAb Catalog No. A11448 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0599 Background
This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural lens protein (tau-crystallin) in the monomeric form. Alternative splicing of this gene results in a shorter isoform that has been shown to bind to the c-myc promoter and function as a tumor suppressor. Several pseudogenes have been identified, including one on the long arm of chromosome 1. Alpha-enolase has also been identified as an autoantigen in Hashimoto encephalopathy.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ENO1 (P06733). Sequence MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGT Gene ID Swiss Prot Synonyms NNE; PPH; MPB1; ENO1L1; ENO1-IT1; HEL-S-17 Calculated MW 47kDa Observed MW 47kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, MCF7, RD, Mouse brain, Mouse spleen, Mouse kidney, Rat brain, Rat spleen, Rat kidney Cellular location Cell membrane, Cytoplasm, M line, Nucleus, myofibril, sarcomere 
Western blot analysis of extracts of various cell lines, using ENO1 Rabbit mAb (A11448) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ENO1 (P06733). Isotype IgG







