быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DAP Kinase 1 (DAPK1) Rabbit mAb (A11459)
- Описание
- Характеристики
-
Overview
Product name DAP Kinase 1 (DAPK1) Rabbit mAb Catalog No. A11459 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0601 Background
Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consensus sites. It is a tumor suppressor candidate. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human DAP Kinase 1 (DAPK1) (P53355). Sequence DFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFAARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIH Gene ID Swiss Prot Synonyms DAPK; ROCO3 Calculated MW 160kDa Observed MW 160kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples OVCAR3, Mouse lung Cellular location Cytoplasm, Cytoskeleton, Cytoskeleton 
Western blot analysis of extracts of various cell lines, using DAP Kinase 1 (DAPK1) Rabbit mAb (A11459) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human DAP Kinase 1 (DAPK1) (P53355). Isotype IgG