быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MAD2/MAD2L1 Rabbit mAb (A11469)
- Описание
- Характеристики
-
Overview
Product name MAD2/MAD2L1 Rabbit mAb Catalog No. A11469 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0603 Background
MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-150 of human MAD2/MAD2L1 (Q13257). Sequence EQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCS Gene ID Swiss Prot Synonyms MAD2; HSMAD2 Calculated MW 24kDa Observed MW 24kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HT-29, HepG2, Raji Cellular location Chromosome, Cytoplasm, Nucleus, centromere, cytoskeleton, kinetochore, spindle pole Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using MAD2/MAD2/MAD2L1 Rabbit mAb (A11469) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using MAD2/MAD2/MAD2L1 Rabbit mAb (A11469) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat spleen using MAD2/MAD2/MAD2L1 Rabbit mAb (A11469) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-150 of human MAD2/MAD2L1 (Q13257). Isotype IgG