быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MCM3 Rabbit mAb (A11475)
- Описание
- Характеристики
-
Overview
Product name MCM3 Rabbit mAb Catalog No. A11475 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0607 Background
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Several transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MCM3 (P25205). Sequence MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYV Gene ID Swiss Prot Synonyms HCC5; P1.h; RLFB; P1-MCM3 Calculated MW 91kDa Observed MW 100kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples HeLa, K-562, C6, Mouse spleen Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using MCM3 Rabbit mAb (A11475) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of Mouse spleen, using MCM3 Rabbit mAb (A11475) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human liver cancer using MCM3 Rabbit mAb (A11475) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat spleen using MCM3 Rabbit mAb (A11475) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of HeLa cells using MCM3 Rabbit mAb (A11475) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using MCM3 Rabbit mAb (A11475) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg MCM3 antibody (A11475). Western blot was performed from the immunoprecipitate using MCM3 antibody (A11475) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MCM3 (P25205). Isotype IgG