быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ATOH1 Rabbit mAb (A11477)
- Описание
- Характеристики
-
Overview
Product name ATOH1 Rabbit mAb Catalog No. A11477 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0609 Background
Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in neuron differentiation; positive regulation of neuron differentiation; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including generation of neurons; inner ear morphogenesis; and positive regulation of inner ear auditory receptor cell differentiation. Predicted to be part of chromatin. Predicted to be active in nucleus.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATOH1 (Q92858). Sequence MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVD Gene ID Swiss Prot Synonyms ATH1; HATH1; DFNA89; MATH-1; bHLHa14 Calculated MW 38kDa Observed MW 45kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, HCT116, A549 Cellular location Nucleus Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using ATOH1 Rabbit mAb (A11477) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATOH1 (Q92858). Isotype IgG