быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Mast Cell Chymase (CMA1) Rabbit mAb (A11480)
- Описание
- Характеристики
-
Overview
Product name Mast Cell Chymase (CMA1) Rabbit mAb Catalog No. A11480 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0614 Background
This gene encodes a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and is thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Alternative splicing results in multiple variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Mast Cell Chymase (CMA1) (CMA1) (P23946). Sequence GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN Gene ID Swiss Prot Synonyms CYH; MCT1; chymase Calculated MW 27kDa Observed MW 27kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples A549, Mouse heart, Rat lung, Rat small intestine Cellular location Cytoplasmic granule, Secreted 
Western blot analysis of extracts of various cell lines, using Mast Cell Chymase (CMA1) (CMA1) Rabbit mAb (A11480) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human appendix using Mast Cell Chymase (CMA1) (CMA1) Rabbit mAb (A11480) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Mast Cell Chymase (CMA1) (CMA1) (P23946). Isotype IgG