быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FABP4 Rabbit mAb (A11481)
- Описание
- Характеристики
-
Overview
Product name FABP4 Rabbit mAb Catalog No. A11481 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0616 Background
FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABP4 (P15090). Sequence MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDG Gene ID Swiss Prot Synonyms aP2; ALBP; AFABP; A-FABP; HEL-S-104 Calculated MW 15kDa Observed MW 15kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse heart, Mouse thymus, Rat heart, Rat thymus Cellular location Cytoplasm, Nucleus Customer validation WB(Sus scrofa, Mus musculus, Rattus norvegicus)
Immunoblot analysis(Mice)
Western blot analysis of extracts of various cell lines, using FABP4 Rabbit mAb (A11481) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABP4 (P15090). Isotype IgG