быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Lamin B1 Rabbit mAb (A11495)
- Описание
- Характеристики
-
Overview
Product name Lamin B1 Rabbit mAb Catalog No. A11495 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0621 Background
This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human Lamin B1 (P20700). Sequence DGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTI Gene ID Swiss Prot Synonyms LMN; ADLD; LMN2; LMNB; MCPH26 Calculated MW 66kDa Observed MW 45kDa/70kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, HeLa+Staurosporine, Jurkat, U-87MG, Mouse liver, Mouse brain, Mouse spleen, Rat liver, Rat testis Cellular location Lipid-anchor, Nucleoplasmic side, Nucleus inner membrane Customer validation WB(Rattus norvegicus, Homo sapiens, Mus musculus)
Western blot analysis of extracts of various cell lines, using Lamin B1 Rabbit mAb (A11495) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry of paraffin-embedded human brain using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon carcinoma using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse colon using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse kidney using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat kidney using Lamin B1 Rabbit mAb (A11495) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human liver cancer using Lamin B1 Rabbit mAb (A11495) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse liver using Lamin B1 Rabbit mAb (A11495) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse testis using Lamin B1 Rabbit mAb (A11495) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat liver using Lamin B1 Rabbit mAb (A11495) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human Lamin B1 (P20700). Isotype IgG