быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CELF1 Rabbit mAb (A1150)
- Описание
- Характеристики
-
Overview
Product name CELF1 Rabbit mAb Catalog No. A1150 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1866 Background
Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CELF1 (Q92879). Sequence MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSE Gene ID Swiss Prot Synonyms CUGBP; NAB50; NAPOR; CUG-BP; CUGBP1; hNab50; BRUNOL2; EDEN-BP Calculated MW 52kDa Observed MW 52kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples SH-SY5Y, Mouse brain, Rat brain Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of SH-SY5Y cells, using CELF1 Rabbit mAb (A1150) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various lysates, using CELF1 Rabbit mAb (A1150) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CELF1 (Q92879). Isotype IgG