быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LOX Rabbit mAb (A11504)
- Описание
- Характеристики
-
Overview
Product name LOX Rabbit mAb Catalog No. A11504 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0624 Background
This gene encodes a member of the lysyl oxidase family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a regulatory propeptide and the mature enzyme. The copper-dependent amine oxidase activity of this enzyme functions in the crosslinking of collagens and elastin, while the propeptide may play a role in tumor suppression. In addition, defects in this gene have been linked with predisposition to thoracic aortic aneurysms and dissections.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 318-417 of human LOX (P28300). Sequence GHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY Gene ID Swiss Prot Synonyms AAT10 Calculated MW 47kDa Observed MW 56kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IP Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples 293T, A549, Jurkat, Mouse lung, Rat lung, Rat spleen Cellular location Secreted, extracellular space Customer validation WB(Mus musculus)
IHC(Homo sapiens)
Western blot analysis of extracts of various cell lines, using LOX Rabbit mAb (A11504) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon using LOX Rabbit mAb (A11504) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using LOX Rabbit mAb (A11504) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg LOX antibody (A11504). Western blot was performed from the immunoprecipitate using LOX antibody (A11504) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 318-417 of human LOX (P28300). Isotype IgG