быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GOLPH2 Rabbit mAb (A11538)
- Описание
- Характеристики
-
Overview
Product name GOLPH2 Rabbit mAb Catalog No. A11538 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0697 Background
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human GOLPH2 (Q8NBJ4). Sequence VEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDD Gene ID Swiss Prot Synonyms GP73; HEL46; GOLPH2; C9orf155; PSEC0257; bA379P1.3 Calculated MW 45kDa Observed MW 80kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HT-29, SGC-7901, Mouse lung, Mouse spleen, Mouse stomach, Rat lung Cellular location Golgi apparatus, Single-pass type II membrane protein, cis-Golgi network membrane 
Western blot analysis of extracts of various cell lines, using GOLPH2 Rabbit mAb (A11538) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human GOLPH2 (Q8NBJ4). Isotype IgG