быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GABA A Receptor beta 2 (GABRB2) Rabbit mAb (A11558)
- Описание
- Характеристики
-
Overview
Product name GABA A Receptor beta 2 (GABRB2) Rabbit mAb Catalog No. A11558 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0631 Background
The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 2 subunit. It is mapped to chromosome 5q34 in a cluster comprised of genes encoding alpha 1 and gamma 2 subunits of the GABA A receptor. Alternative splicing of this gene generates 2 transcript variants, differing by a 114 bp insertion.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human GABA A Receptor beta 2 (GABRB2) (GABRB2) (P47870). Sequence PYVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKIFYKDIKQNGTQYRSLWDPTGNLSPTRRTTNYDFSLYTMDP Gene ID Swiss Prot Synonyms DEE92; ICEE2 Calculated MW 59kDa Observed MW 63kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples SH-SY5Y, Mouse liver, Mouse brain, Mouse spleen, Rat liver, Rat brain Cellular location Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse 
Western blot analysis of extracts of various cell lines, using GABA A Receptor beta 2 (GABRB2) Rabbit mAb (A11558) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human GABA A Receptor beta 2 (GABRB2) (GABRB2) (P47870). Isotype IgG