быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DIAPH1 Rabbit mAb (A11596)
- Описание
- Характеристики
-
Overview
Product name DIAPH1 Rabbit mAb Catalog No. A11596 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0639 Background
This gene is a homolog of the Drosophila diaphanous gene, and has been linked to autosomal dominant, fully penetrant, nonsyndromic sensorineural progressive low-frequency hearing loss. Actin polymerization involves proteins known to interact with diaphanous protein in Drosophila and mouse. It has therefore been speculated that this gene may have a role in the regulation of actin polymerization in hair cells of the inner ear. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DIAPH1 (O60610). Sequence MEPPGGSLGPGRGTRDKKKGRSPDELPSAGGDGGKSKKFTLKRLMADELERFTSMRIKKEKEKPNSAHRNSSASYGDDPTAQSLQDVSDEQVLVLFEQML Gene ID Swiss Prot Synonyms DIA1; DRF1; DFNA1; LFHL1; SCBMS; hDIA1; mDia1 Calculated MW 141kDa Observed MW 180kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, Mouse lung, Rat testis Cellular location Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Ruffle membrane, Nucleus 
Western blot analysis of extracts of 293T cells, using DIAPH1 Rabbit mAb (A11596) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using DIAPH1 Rabbit mAb (A11596) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DIAPH1 (O60610). Isotype IgG