быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Kininogen 1 (KNG1) Rabbit mAb (A11638)
- Описание
- Характеристики
-
Overview
Product name Kininogen 1 (KNG1) Rabbit mAb Catalog No. A11638 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0653 Background
This gene uses alternative splicing to generate two different proteins- high molecular weight kininogen (HMWK) and low molecular weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, bradykinin, a peptide causing numerous physiological effects, is released from HMWK. Bradykinin also functions as an antimicrobial peptide with antibacterial and antifungal activity. In contrast to HMWK, LMWK is not involved in blood coagulation. Infection with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) reduces or depletes angiotensin converting enzyme 2 (ACE2), which results in an increase in levels of des-Arg(9)-bradykinin, a bioactive metabolite of bradykinin that is associated with lung injury and inflammation. Three transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 545-644 of human Kininogen 1 (KNG1) (NP_001095886.1). Sequence PTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS Gene ID Swiss Prot Synonyms BK; HK; BDK; KNG; HAE6; HMWK Calculated MW 44kDa/48kDa/72kDa Observed MW 46kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, HepG2, Mouse kidney, Rat liver, Rat kidney Cellular location Secreted, extracellular space 
Western blot analysis of extracts of various cell lines, using Kininogen 1 (KNG1) (KNG1) Rabbit mAb (A11638) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using Kininogen 1 (KNG1) (KNG1) Rabbit mAb (A11638) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 545-644 of human Kininogen 1 (KNG1) (NP_001095886.1). Isotype IgG







