быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FKBP12 Rabbit mAb (A11641)
- Описание
- Характеристики
-
Overview
Product name FKBP12 Rabbit mAb Catalog No. A11641 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0654 Background
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 29-108 of human FKBP12 (P62942). Sequence GMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE Gene ID Swiss Prot Synonyms FKBP1; PKC12; PKCI2; FKBP12; PPIASE; FKBP-12; FKBP-1A Calculated MW 12kDa Observed MW 14kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-251MG, Mouse brain, Rat brain, Rat heart Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using FKBP12 Rabbit mAb (A11641) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts of U-251MG cells, using FKBP12 Rabbit mAb (A11641) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 29-108 of human FKBP12 (P62942). Isotype IgG