быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
beta 2 Microglobulin Rabbit mAb (A11642)
- Описание
- Характеристики
-
Overview
Product name beta 2 Microglobulin Rabbit mAb Catalog No. A11642 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0656 Background
This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 40-119 of human beta 2 Microglobulin (P61769). Sequence SNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM Gene ID Swiss Prot Synonyms IMD43 Calculated MW 14kDa Observed MW 14kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, HepG2, Jurkat, Mouse lung, Rat lung, Rat liver Cellular location Secreted Customer validation (Hela 、RPMI-8226 、HepG2 、EFE-184 、Pfeiffer)
Western blot analysis of extracts of various cell lines, using beta 2 Microglobulin Rabbit mAb (A11642) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded human esophageal using beta 2 Microglobulin Rabbit mAb (A11642) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 40-119 of human beta 2 Microglobulin (P61769). Isotype IgG