быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GluR1/GRIA1 Rabbit mAb (A11643)
- Описание
- Характеристики
-
Overview
Product name GluR1/GRIA1 Rabbit mAb Catalog No. A11643 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0657 Background
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-906 of human GluR1/GRIA1 (P42261). Sequence ALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL Gene ID Swiss Prot Synonyms GLUH1; GLUR1; GLURA; GluA1; HBGR1; MRD67; MRT76 Calculated MW 102kDa Observed MW 102kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse brain, Rat brain Cellular location Cell junction, Cell membrane, Cell projection, Endoplasmic reticulum membrane, Multi-pass membrane protein, dendrite, dendritic spine, postsynaptic cell membrane, postsynaptic density, synapse Customer validation WB(Rattus norvegicus)

Western blot analysis of extracts of various cell lines, using GluR1/GRIA1 Rabbit mAb (A11643) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-906 of human GluR1/GRIA1 (P42261). Isotype IgG







