быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Collagen X/COL10A1 Rabbit mAb (A11645)
- Описание
- Характеристики
-
Overview
Product name Collagen X/COL10A1 Rabbit mAb Catalog No. A11645 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0659 Background
This gene encodes the alpha chain of type X collagen, a short chain collagen expressed by hypertrophic chondrocytes during endochondral ossification. Unlike type VIII collagen, the other short chain collagen, type X collagen is a homotrimer. Mutations in this gene are associated with Schmid type metaphyseal chondrodysplasia (SMCD) and Japanese type spondylometaphyseal dysplasia (SMD).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Collagen X/COL10A1 (Q03692). Sequence HSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFS Gene ID Swiss Prot Synonyms COL10A1; collagen alpha-1(X) chain Calculated MW 66kDa Observed MW 66kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse liver, Rat liver Cellular location Secreted, extracellular matrix, extracellular space Customer validation WB(Gallus gallus, Mus musculus)
Western blot analysis of extracts of various cell lines, using Collagen X/COL10A1 Rabbit mAb (A11645) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Collagen X/COL10A1 (Q03692). Isotype IgG