быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HB-EGF Rabbit mAb (A11657)
- Описание
- Характеристики
-
Overview
Product name HB-EGF Rabbit mAb Catalog No. A11657 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0663 Background
Enables growth factor activity and heparin binding activity. Involved in several processes, including epidermal growth factor receptor signaling pathway; positive regulation of protein kinase B signaling; and positive regulation of wound healing. Located in cell surface and extracellular space. Implicated in glomerulosclerosis and perinatal necrotizing enterocolitis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HB-EGF (Q99075). Sequence LLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPV Gene ID Swiss Prot Synonyms DTR; DTS; DTSF; HEGFL Calculated MW 23kDa Observed MW 18-28kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples SK-OV-3, Mouse lung, Mouse spleen, Rat spleen Cellular location Cell membrane, Secreted, Single-pass type I membrane protein, extracellular space 
Western blot analysis of extracts of various cell lines, using HB-EGF antibody (A11657) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HB-EGF (Q99075). Isotype IgG