быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FBP1 Rabbit mAb (A11664)
- Описание
- Характеристики
-
Overview
Product name FBP1 Rabbit mAb Catalog No. A11664 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0664 Background
Fructose-1, 6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1, 6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1, 6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 239-338 of human FBP1 (P09467). Sequence APYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQ Gene ID Swiss Prot Synonyms FBP Calculated MW 37kDa Observed MW 40kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples MCF7 Cellular location cytoplasm, cytosol, extracellular exosome, nucleus 
Western blot analysis of extracts of MCF7 cells, using FBP1 Rabbit mAb (A11664) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunofluorescence analysis of HeLa cells using FBP1 Rabbit mAb (A11664) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of rat kidney using FBP1 Rabbit mAb (A11664) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse kidney using FBP1 Rabbit mAb (A11664) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 239-338 of human FBP1 (P09467). Isotype IgG