быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GLUT1/SLC2A1 Rabbit mAb (A11727)
- Описание
- Характеристики
-
Overview
Product name GLUT1/SLC2A1 Rabbit mAb Catalog No. A11727 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0304 Background
This gene encodes a major glucose transporter in the mammalian blood-brain barrier. The encoded protein is found primarily in the cell membrane and on the cell surface, where it can also function as a receptor for human T-cell leukemia virus (HTLV) I and II. Mutations in this gene have been found in a family with paroxysmal exertion-induced dyskinesia.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 393-492 of human GLUT1/SLC2A1 (P11166). Sequence ELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV Gene ID Swiss Prot Synonyms CSE; PED; DYT9; GLUT; DYT17; DYT18; EIG12; GLUT1; HTLVR; GLUT-1; SDCHCN; GLUT1DS Calculated MW 54kDa Observed MW 45kDa Applications
Reactivity Human, Mouse Tested applications WB IP Recommended dilution - WB 1:500 - 1:2000
- IP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples SH-SY5Y, K-562, Mouse brain Cellular location Cell membrane, Melanosome, Multi-pass membrane protein Customer validation WB(Rattus norvegicus, Homo sapiens, Mus musculus, Rattus norvegicus )
IHC(Homo sapiens,Rattus norvegicus )
Western blot analysis of extracts of various cell lines, using GLUT1/SLC2A1 Rabbit mAb (A11727) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 393-492 of human GLUT1/SLC2A1 (P11166). Isotype IgG