быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
S6 Ribosomal Protein (RPS6) Rabbit mAb (A11874)
- Описание
- Характеристики
-
Overview
Product name S6 Ribosomal Protein (RPS6) Rabbit mAb Catalog No. A11874 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC50655 Background
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RPS6 (NP_001001.2). Sequence MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVP Gene ID Swiss Prot Synonyms S6; eS6 Calculated MW 29kDa Observed MW 32kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, NIH/3T3, Mouse thymus, Mouse liver, Rat liver Cellular location cytoplasm, cytoplasmic ribonucleoprotein granule, cytosol, cytosolic ribosome, endoplasmic reticulum, nucleolus, nucleoplasm, nucleus, perinuclear region of cytoplasm Customer validation WB(Danio rerio, Homo sapiens)
Western blot analysis of extracts from various cell lines, using S6 Ribosomal Protein (RPS6) antibody (A11874) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Confocal imaging of NIH/3T3 cells using S6 Ribosomal Protein (RPS6) Rabbit mAb (A11874, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Confocal imaging of C6 cells using S6 Ribosomal Protein (RPS6) Rabbit mAb (A11874, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RPS6 (NP_001001.2). Isotype IgG