быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Myeloperoxidase (MPO) Rabbit mAb (A12109)
- Описание
- Характеристики
-
Overview
Product name Myeloperoxidase (MPO) Rabbit mAb Catalog No. A12109 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53227 Background
Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of neutrophils.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 646-745 of human Myeloperoxidase (MPO) (NP_000241.1). Sequence GVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS Gene ID Swiss Prot Synonyms Calculated MW 84kDa Observed MW 13kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HL-60 cells Cellular location Cytoplasm 
Western blot analysis of extracts of HL-60 cells, using Myeloperoxidase (MPO) antibody (A12109) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry of paraffin-embedded human colon carcinoma using Myeloperoxidase (MPO) Rabbit mAb (A12109) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human extranodal NK-T cell lymphoma using Myeloperoxidase (MPO) Rabbit mAb (A12109) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded Human hepatocholangiocarcinoma using Myeloperoxidase (MPO) Rabbit mAb (A12109) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human liver using Myeloperoxidase (MPO) Rabbit mAb (A12109) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human tonsil using Myeloperoxidase (MPO) Rabbit mAb (A12109) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 646-745 of human Myeloperoxidase (MPO) (NP_000241.1). KO Validated Validated Isotype IgG