быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MERTK Rabbit mAb (A12294)
- Описание
- Характеристики
-
Overview
Product name MERTK Rabbit mAb Catalog No. A12294 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0229 Background
This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MERTK (Q12866). Sequence MGPAPLPLLLGLFLPALWRRAITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTV Gene ID Swiss Prot Synonyms MER; RP38; c-Eyk; c-mer; Tyro12 Calculated MW 110kDa Observed MW 150-200kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Hep G2 Cellular location Cell membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of HepG2 cells, using MERTK Rabbit mAb (A12294) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MERTK (Q12866). Isotype IgG