быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LGR5/GPR49 Rabbit mAb (A12327)
- Описание
- Характеристики
-
Overview
Product name LGR5/GPR49 Rabbit mAb Catalog No. A12327 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0321 Background
The protein encoded by this gene is a leucine-rich repeat-containing receptor (LGR) and member of the G protein-coupled, 7-transmembrane receptor (GPCR) superfamily. The encoded protein is a receptor for R-spondins and is involved in the canonical Wnt signaling pathway. This protein plays a role in the formation and maintenance of adult intestinal stem cells during postembryonic development. Several transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-907 of human LGR5/GPR49 (O75473). Sequence VIKFILLVVVPLPACLNPLLYILFNPHFKEDLVSLRKQTYVWTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSSVAFVPCL Gene ID Swiss Prot Synonyms FEX; HG38; GPR49; GPR67; GRP49 Calculated MW 100kDa Observed MW 110kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse ovary, Mouse brain, Rat testis, Rat brain Cellular location Cell membrane, Golgi apparatus, Multi-pass membrane protein, trans-Golgi network membrane Customer validation IHC (Mus musculus)
Western blot analysis of extracts of various cell lines, using LGR5/GPR49 Rabbit mAb (A12327) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-907 of human LGR5/GPR49 (O75473). Isotype IgG