быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Dot1L/KMT4 Rabbit mAb (A12329)
- Описание
- Характеристики
-
Overview
Product name Dot1L/KMT4 Rabbit mAb Catalog No. A12329 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0688 Background
The protein encoded by this gene is a histone methyltransferase that methylates lysine-79 of histone H3. It is inactive against free core histones, but shows significant histone methyltransferase activity against nucleosomes.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dot1L/KMT4 (NP_115871.1). Sequence MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNT Gene ID Swiss Prot Synonyms DOT1; KMT4 Calculated MW 165kDa Observed MW 170kDa Applications
Reactivity Human, Mouse Tested applications WB IP Recommended dilution - WB 1:500 - 1:1000
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples HeLa, U-87MG, Mouse brain Cellular location Nucleus Customer validation WB(Mus musculus, Homo sapiens)
Western blot analysis of extracts of various cell lines, using Dot1L/KMT4 Rabbit mAb (A12329) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunoprecipitation analysis of 300 μg extracts from HeLa cells using 3 μg Dot1L/KMT4 Rabbit mAb (A12329). Western blot was performed from the immunoprecipitate using Dot1L/KMT4 Rabbit mAb (A12329) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dot1L/KMT4 (NP_115871.1). Isotype IgG