быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NSD3/WHSC1L1 Rabbit mAb (A12342)
- Описание
- Характеристики
-
Overview
Product name NSD3/WHSC1L1 Rabbit mAb Catalog No. A12342 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0707 Background
This gene is related to the Wolf-Hirschhorn syndrome candidate-1 gene and encodes a protein with PWWP (proline-tryptophan-tryptophan-proline) domains. This protein methylates histone H3 at lysine residues 4 and 27, which represses gene transcription. Two alternatively spliced variants have been described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NSD3/WHSC1L1 (Q9BZ95). Sequence MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNNSDIAEDGGQTPYEATLQQGFQYPATTEDLPPLTNGYPSSISVYETQTKYQSYNQYPNGSANGF Gene ID Swiss Prot Synonyms KMT3F; KMT3G; WHISTLE; WHSC1L1; pp14328 Calculated MW 162kDa Observed MW 80-100kDa/200kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A549, U-251MG, Mouse liver, Mouse testis, Mouse brain, Rat brain Cellular location Chromosome, Nucleus 
Western blot analysis of extracts of various cell lines, using NSD3/WHSC1L1 Rabbit mAb (A12342) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NSD3/WHSC1L1 (Q9BZ95). Isotype IgG