быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DNA topoisomerase I (TOP1) Rabbit mAb (A12409)
- Описание
- Характеристики
-
Overview
Product name DNA topoisomerase I (TOP1) Rabbit mAb Catalog No. A12409 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0708 Background
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (TOP1) (P11387). Sequence MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA Gene ID Swiss Prot Synonyms TOPI Calculated MW 91kDa Observed MW 100kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples Mouse thymus, HeLa, MCF7, NIH/3T3, K-562 Cellular location Nucleus, nucleolus, nucleoplasm 
Western blot analysis of extracts of various cell lines, using DNA topoisomerase I (DNA topoisomerase I (TOP1)) Rabbit mAb (A12409) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of Mouse thymus, using DNA topoisomerase I (DNA topoisomerase I (TOP1)) Rabbit mAb (A12409) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using DNA topoisomerase I (DNA topoisomerase I (TOP1)) Rabbit mAb (A12409) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Confocal imaging of U-2 OS cells using DNA topoisomerase I (TOP1) Rabbit mAb (A12409, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Immunoprecipitation analysis of 300 μg extracts of MCF7 cells using 3 μg DNA topoisomerase I (TOP1) antibody (A12409). Western blot was performed from the immunoprecipitate using DNA topoisomerase I (TOP1) antibody (A12409) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (TOP1) (P11387). Isotype IgG