быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PCNA Rabbit mAb (A12427)
- Описание
- Характеристики
-
Overview
Product name PCNA Rabbit mAb Catalog No. A12427 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51324 Background
The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 162-261 of human PCNA (NP_002583.1). Sequence CAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS Gene ID Swiss Prot Synonyms ATLD2 Calculated MW 29kDa Observed MW 35kDa Applications
Reactivity Human, Mouse, Rat, African green monkey Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:2000 - 1:10000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa cells, MCF7 cells, 293T cells, C2C12 cells, COS-7 cells, Mouse spleen, Rat testis Cellular location Nucleus Customer validation (H226)
WB(Mus musculus, Homo sapiens, Mus musculus、Sus scrofa, Rattus norvegicus)
IHC(Rattus norvegicus, Homo sapiens)
IF(Rattus norvegicus)
IF(Mus musculus, Homo sapiens)
IHC(Mus musculus, Homo sapiens)
PCR(Mus musculus)
Western blot analysis of various lysates, using PCNA antibody (A12427) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry of paraffin-embedded human liver using PCNA Rabbit mAb (A12427) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human lung squamous carcinoma tissue using PCNA Rabbit mAb (A12427) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse testis using PCNA Rabbit mAb (A12427) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human esophagus using PCNA Rabbit mAb (A12427) at dilution of 1:8000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Зелёная мартышка (African green monkey) Immunogen A synthetic peptide corresponding to a sequence within amino acids 162-261 of human PCNA (NP_002583.1). KO Validated Validated Isotype IgG