быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MEK5 Rabbit mAb (A12457)
- Описание
- Характеристики
-
Overview
Product name MEK5 Rabbit mAb Catalog No. A12457 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0711 Background
The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, as well as by atypical protein kinase C isoforms (aPKCs). The signal cascade mediated by this kinase is involved in growth factor stimulated cell proliferation and muscle cell differentiation. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human MEK5 (Q13163). Sequence DVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELA Gene ID Swiss Prot Synonyms MEK5 Calculated MW 50kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse testis, Rat liver, RD Cellular location Cytosol, Nucleus, Spindle 
Western blot analysis of extracts of RD cells, using MEK5 Rabbit mAb (A12457) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts of various cell lines, using MEK5 Rabbit mAb (A12457) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human MEK5 (Q13163). Isotype IgG