быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PEBP1 Rabbit mAb (A12768)
- Описание
- Характеристики
-
Overview
Product name PEBP1 Rabbit mAb Catalog No. A12768 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0704 Background
This gene encodes a member of the phosphatidylethanolamine-binding family of proteins and has been shown to modulate multiple signaling pathways, including the MAP kinase (MAPK), NF-kappa B, and glycogen synthase kinase-3 (GSK-3) signaling pathways. The encoded protein can be further processed to form a smaller cleavage product, hippocampal cholinergic neurostimulating peptide (HCNP), which may be involved in neural development. This gene has been implicated in numerous human cancers and may act as a metastasis suppressor gene. Multiple pseudogenes of this gene have been identified in the genome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PEBP1 (P30086). Sequence MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSG Gene ID Swiss Prot Synonyms PBP; HCNP; PEBP; RKIP; HCNPpp; PEBP-1; HEL-210; HEL-S-34; HEL-S-96 Calculated MW 21kDa Observed MW 21kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, Mouse liver, Mouse brain, Mouse thymus, Rat liver, Rat brain, Rat thymus Cellular location Cytoplasm Customer validation (293T、T47D、SKVO-3、MOLT-4、HepG2、PC-3)

Western blot analysis of extracts of various cell lines, using PEBP1 Rabbit mAb (A12768) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
-
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PEBP1 (P30086). Isotype IgG







