быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ESRα Rabbit mAb (A12976)
- Описание
- Характеристики
-
Overview
Product name ESRα Rabbit mAb Catalog No. A12976 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0199 Background
This gene encodes an estrogen receptor and ligand-activated transcription factor. The canonical protein contains an N-terminal ligand-independent transactivation domain, a central DNA binding domain, a hinge domain, and a C-terminal ligand-dependent transactivation domain. The protein localizes to the nucleus where it may form either a homodimer or a heterodimer with estrogen receptor 2. The protein encoded by this gene regulates the transcription of many estrogen-inducible genes that play a role in growth, metabolism, sexual development, gestation, and other reproductive functions and is expressed in many non-reproductive tissues. The receptor encoded by this gene plays a key role in breast cancer, endometrial cancer, and osteoporosis. This gene is reported to have dozens of transcript variants due to the use of alternate promoters and alternative splicing, however, the full-length nature of many of these variants remain uncertain.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Estrogen Receptor alpha (ESRα) (P03372). Sequence AVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFY Gene ID Swiss Prot Synonyms ER; ESR; Era; ESRA; ESTRR; NR3A1 Calculated MW 66kDa Observed MW 66kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:1000 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples MCF7 Cellular location Cell membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic side, Golgi apparatus, Nucleus, Peripheral membrane protein, Single-pass type I membrane protein Customer validation WB(Homo sapiens, Mus musculus)

Western blot analysis of extracts of MCF7 cells, using Estrogen Receptor alpha (ESRα) antibody ( A12976) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.
Immunofluorescence analysis of MCF-7 cells using ER alpha antibody (A12976). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Estrogen Receptor alpha (ESRα) (P03372). Isotype IgG







