быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HDAC4 Rabbit mAb (A13510)
- Описание
- Характеристики
-
Overview
Product name HDAC4 Rabbit mAb Catalog No. A13510 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0714 Background
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. This protein does not bind DNA directly, but through transcription factors MEF2C and MEF2D. It seems to interact in a multiprotein complex with RbAp48 and HDAC3.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC4 (P56524). Sequence MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQL Gene ID Swiss Prot Synonyms HD4; AHO3; BDMR; HDACA; HA6116; HDAC-4; HDAC-A; NEDCHF; NEDCHID Calculated MW 119kDa Observed MW 140kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Jurkat, THP-1 Cellular location Cytoplasm, Nucleus 
Western blot analysis of various lysates, using HDAC4 antibody (A13510) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC4 (P56524). Isotype IgG