быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HSPB8/HSP22 Rabbit mAb (A13518)
- Описание
- Характеристики
-
Overview
Product name HSPB8/HSP22 Rabbit mAb Catalog No. A13518 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0715 Background
The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HSPB8/HSP22 (Q9UJY1). Sequence MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCV Gene ID Swiss Prot Synonyms H11; HMN2; CMT2L; DHMN2; E2IG1; HMN2A; HSP22; CRYAC Calculated MW 22kDa Observed MW 24kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse heart, Rat heart Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using HSPB8/HSP22 Rabbit mAb (A13518) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunofluorescence analysis of NIH-3T3 cells using HSPB8/HSP22 Rabbit mAb (A13518) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using HSPB8/HSP22 Rabbit mAb (A13518) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HSPB8/HSP22 (Q9UJY1). Isotype IgG