быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
S100A10 Rabbit mAb (A13614)
- Описание
- Характеристики
-
Overview
Product name S100A10 Rabbit mAb Catalog No. A13614 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0720 Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-97 of human S100A10 (P60903). Sequence MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK Gene ID Swiss Prot Synonyms 42C; P11; p10; GP11; ANX2L; CAL1L; CLP11; Ca[1]; ANX2LG Calculated MW 11kDa Observed MW 11kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples A549, U-87MG Cellular location cell surface, cytoplasm, extracellular exosome, extracellular region, extracellular space, nuclear matrix, plasma membrane protein complex Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using S100A10 Rabbit mAb (A13614) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human esophageal using S100A10 Rabbit mAb (A13614) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-97 of human S100A10 (P60903). Isotype IgG