быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HGD Rabbit mAb (A1400)
- Описание
- Характеристики
-
Overview
Product name HGD Rabbit mAb Catalog No. A1400 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2561 Background
This gene encodes the enzyme homogentisate 1, 2 dioxygenase. This enzyme is involved in the catabolism of the amino acids tyrosine and phenylalanine. Mutations in this gene are the cause of the autosomal recessive metabolism disorder alkaptonuria.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 346-445 of human HGD (Q93099). Sequence IRGHYEAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN Gene ID Swiss Prot Synonyms AKU; HGO Calculated MW 50kDa Observed MW 50kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HT-29, HepG2 Cellular location Cytosol, extracellular exosome 
Western blot analysis of extracts of various cell lines, using HGD antibody (A1400) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 346-445 of human HGD (Q93099). Isotype IgG