быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
S1PR3 Rabbit mAb (A1404)
- Описание
- Характеристики
-
Overview
Product name S1PR3 Rabbit mAb Catalog No. A1404 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1877 Background
This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human S1PR3 (Q99500). Sequence MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSG Gene ID Swiss Prot Synonyms EDG3; LPB3; S1P3; EDG-3; C9orf47; C9orf108; bA791O21.3 Calculated MW 42kDa Observed MW 42kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, PC-3, Mouse lung, Mouse kidney, Mouse thymus, Rat lung, Rat spleen Cellular location Cell membrane, Multi-pass membrane protein 
Western blot analysis of extracts of various cell lines, using S1PR3 Rabbit mAb (A1404) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human S1PR3 (Q99500). Isotype IgG