быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GAD67/GAD1 Rabbit mAb (A1475)
- Описание
- Характеристики
-
Overview
Product name GAD67/GAD1 Rabbit mAb Catalog No. A1475 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1879 Background
This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67-kD form and a less-frequent 25-kD form.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GAD67/GAD1 (Q99259). Sequence MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFA Gene ID Swiss Prot Synonyms GAD; SCP; CPSQ1; DEE89 Calculated MW 67kDa Observed MW 70kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, U-251MG, Mouse lung, Rat lung Cellular location Axon terminus, Cell cortex, Cytoplasm, GABA-ergic synapse, Inhibitory synapse, Plasma membrane, Presynaptic active zone 
Western blot analysis of extracts of various cell lines, using GAD67/GAD1 Rabbit mAb (A1475) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using GAD67/GAD1 Rabbit mAb (A1475) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GAD67/GAD1 (Q99259). Isotype IgG







