быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PDCD7 Rabbit mAb (A1510)
- Описание
- Характеристики
-
Overview
Product name PDCD7 Rabbit mAb Catalog No. A1510 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2564 Background
This gene encodes a 59 kDa protein that is associated with the U11 small nuclear ribonucleoprotein (snRNP), which is a component of the minor U12-type spliceosome responsible for catalyzing pre-mRNA splicing of U12-type introns.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PDCD7 (Q8N8D1). Sequence MALPPFFGQGRPGPPPPQPPPPAPFGCPPPPLPSPAFPPPLPQRPGPFPGASAPFLQPPLALQPRASAEASRGGGGAGAFYPVPPPPLPPPPPQCRPFPG Gene ID Swiss Prot Synonyms 59K; ES18; HES18 Calculated MW 55kDa Observed MW 55kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples TE-1, SK-OV-3, Mouse testis, Mouse thymus, Rat brain Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using PDCD7 antibody (A1510) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of Rat brain, using PDCD7 antibody (A1510) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using PDCD7 Rabbit mAb (A1510) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse heart using PDCD7 Rabbit mAb (A1510) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat liver using PDCD7 Rabbit mAb (A1510) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PDCD7 (Q8N8D1). Isotype IgG