быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PABPN1 Rabbit mAb (A1735)
- Описание
- Характеристики
-
Overview
Product name PABPN1 Rabbit mAb Catalog No. A1735 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0730 Background
This gene encodes an abundant nuclear protein that binds with high affinity to nascent poly(A) tails. The protein is required for progressive and efficient polymerization of poly(A) tails at the 3' ends of eukaryotic transcripts and controls the size of the poly(A) tail to about 250 nt. At steady-state, this protein is localized in the nucleus whereas a different poly(A) binding protein is localized in the cytoplasm. This gene contains a GCG trinucleotide repeat at the 5' end of the coding region, and expansion of this repeat from the normal 6 copies to 8-13 copies leads to autosomal dominant oculopharyngeal muscular dystrophy (OPMD) disease. Related pseudogenes have been identified on chromosomes 19 and X. Read-through transcription also exists between this gene and the neighboring upstream BCL2-like 2 (BCL2L2) gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PABPN1 (Q86U42). Sequence MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEE Gene ID Swiss Prot Synonyms OPMD; PAB2; PABII; PABP2; PABP-2 Calculated MW 31kDa/33kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, HepG2, Raji, Mouse lung, Mouse brain, Rat brain Cellular location Cytoplasm, Nucleus Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using PABPN1 Rabbit mAb (A1735) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat brain using PABPN1 Rabbit mAb (A1735) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human esophageal using PABPN1 Rabbit mAb (A1735) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse testis using PABPN1 Rabbit mAb (A1735) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using PABPN1 Rabbit mAb (A1735) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using PABPN1 Rabbit mAb (A1735) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using PABPN1 Rabbit mAb (A1735) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PABPN1 (Q86U42). Isotype IgG