быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CHD1L Rabbit mAb (A17558)
- Описание
- Характеристики
-
Overview
Product name CHD1L Rabbit mAb Catalog No. A17558 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2153 Background
This gene encodes a DNA helicase protein involved in DNA repair. The protein converts ATP to add poly(ADP-ribose) as it regulates chromatin relaxation following DNA damage. Overexpression of this gene has been linked to several types of cancers.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human CHD1L (NP_004275.). Sequence GEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLAL Gene ID Swiss Prot Synonyms ALC1; CHDL Calculated MW 101kDa Observed MW 101kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Hep G2 Cellular location Cytosol, Chromosome, Nucleus, plasma membrane 
Western blot analysis of extracts of HepG2 cells, using CHD1L Rabbit mAb (A17558) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human CHD1L (NP_004275.). Isotype IgG