быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Caspase-3 Mouse mAb (A17900)
- Описание
- Характеристики
-
Overview
Product name Caspase-3 Mouse mAb Catalog No. A17900 Host species Mouse Purification method Affinity purification Isotype IgG1, Kappa CloneNo. AMC0214 Background
The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 55-160 of human Caspase-3 (P42574). Sequence FHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII Gene ID Swiss Prot Synonyms CPP32; SCA-1; CPP32B Calculated MW 32kDa Observed MW 32kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples Jurkat, HeLa, 293T, Mouse lung, Mouse liver Cellular location Cytoplasm Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using Caspase-3 antibody (A17900) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Мышь Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 55-160 of human Caspase-3 (P42574). Isotype IgG1, Kappa