быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Bmi1 Rabbit mAb (A17914)
- Описание
- Характеристики
-
Overview
Product name Bmi1 Rabbit mAb Catalog No. A17914 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0376 Background
This gene encodes a ring finger protein that is major component of the polycomb group complex 1 (PRC1). This complex functions through chromatin remodeling as an essential epigenetic repressor of multiple regulatory genes involved in embryonic development and self-renewal in somatic stem cells. This protein also plays a central role in DNA damage repair. This gene is an oncogene and aberrant expression is associated with numerous cancers and is associated with resistance to certain chemotherapies. A pseudogene of this gene is found on chromosome X. Read-through transcription also exists between this gene and the upstream COMM domain containing 3 (COMMD3) gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 227-326 of human Bmi1 (P35226). Sequence VRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG Gene ID Swiss Prot Synonyms PCGF4; RNF51; FLVI2/BMI1; flvi-2/bmi-1 Calculated MW 37kDa Observed MW 40kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples K-562, Rat testis Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using Bmi1 antibody (A17914) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 227-326 of human Bmi1 (P35226). Isotype IgG