быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SDHB Rabbit mAb (A1809)
- Описание
- Характеристики
-
Overview
Product name SDHB Rabbit mAb Catalog No. A1809 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0733 Background
This tumor suppressor gene encodes the iron-sulfur protein subunit of the succinate dehydrogenase (SDH) enzyme complex which plays a critical role in mitochondria. The SDH enzyme complex is composed of four nuclear-encoded subunits. This enzyme complex converts succinate to fumarate which releases electrons as part of the citric acid cycle, and the enzyme complex additionally provides an attachment site for released electrons to be transferred to the oxidative phosphorylation pathway. The SDH enzyme complex plays a role in oxygen-related gene regulation through its conversion of succinate, which is an oxygen sensor that stabilizes the hypoxia-inducible factor 1 (HIF1) transcription factor. Sporadic and familial mutations in this gene result in paragangliomas, pheochromocytoma, and gastrointestinal stromal tumors, supporting a link between mitochondrial dysfunction and tumorigenesis. Mutations in this gene are also implicated in nuclear type 4 mitochondrial complex II deficiency.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 181-280 of human SDHB (P21912). Sequence DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV Gene ID Swiss Prot Synonyms IP; SDH; CWS2; PGL4; SDH1; SDH2; SDHIP; MC2DN4 Calculated MW 32kDa Observed MW 32kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Hep G2, U-87MG, Mouse lung, Mouse liver, Mouse brain, Rat liver, Rat brain Cellular location Matrix side, Mitochondrion inner membrane, Peripheral membrane protein Customer validation WB(Mus musculus, Homo sapiens)

Western blot analysis of extracts of various cell lines, using SDHB Rabbit mAb (A1809) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 181-280 of human SDHB (P21912). Isotype IgG







