быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NF-kB p65/RelA Mouse mAb (A18210)
- Описание
- Характеристики
-
Overview
Product name NF-kB p65/RelA Mouse mAb Catalog No. A18210 Host species Mouse Purification method Affinity purification Isotype IgG2b, kappa CloneNo. AMC0222 Background
NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-551 of human NF-kB p65/RelA (Q04206). Sequence LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS Gene ID Swiss Prot Synonyms p65; CMCU; NFKB3; AIF3BL3 Calculated MW 60kDa Observed MW 65kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, C6, Mouse lung Cellular location Cytoplasm, Nucleus Customer validation WB(Mouse sapiens , Mus musculus)
Western blot analysis of extracts of various cell lines, using NF-kB p65/RelA antibody (A18210) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of U2OS cells using NF-kB p65/RelA antibody (A18210) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of L929 cells using NF-kB p65/RelA antibody (A18210) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Мышь Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-551 of human NF-kB p65/RelA (Q04206). Isotype IgG2b, kappa