быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD31/PECAM1 Rabbit mAb (A18643)
- Описание
- Характеристики
-
Overview
Product name CD31/PECAM1 Rabbit mAb Catalog No. A18643 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC5013-03 Background
The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4). Sequence AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT Gene ID Swiss Prot Synonyms CD31; PECA1; GPIIA'; PECAM-1; endoCAM; CD31/EndoCAM Calculated MW 83kDa Observed MW 140kDa Applications
Reactivity Human Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
- IP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples U-937, THP-1 Cellular location Cell junction, Cell membrane, Single-pass type I membrane protein Customer validation IHC(Homo sapiens)
IF(Homo sapiens)
Western blot analysis of extracts of various cell lines, using CD31/PECAM1 antibody (A18643) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunofluorescence analysis of human placenta using CD31/PECAM1 Rabbit mAb (A18643) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 200 μg extracts of THP-1 using 3 μg CD31/PECAM1 antibody (A18643). Western blot was performed from the immunoprecipitate using CD31/PECAM1 antibody (A18643) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4). Isotype IgG