быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Caveolin-1 Rabbit mAb (A19006)
- Описание
- Характеристики
-
Overview
Product name Caveolin-1 Rabbit mAb Catalog No. A19006 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC50848 Background
The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human Caveolin-1 (NP_001744.2). Sequence MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHS Gene ID Swiss Prot Synonyms CGL3; PPH3; BSCL3; LCCNS; VIP21; MSTP085 Calculated MW 17kDa/20kDa Observed MW 21kDa/24kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:2000 - 1:10000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa cells, Mouse lung , Rat lung Cellular location Cell membrane, Golgi apparatus membrane, Membrane, Membrane raft, Peripheral membrane protein, caveola Customer validation WB(Mus musculus, Homo sapiens, Rattus norvegicus)
IF(Sus scrofa)
WB(Sus scrofa)
IP(Rattus norvegicus)
IF(Rattus norvegicus)
Western blot analysis of various lysates, using Caveolin-1 antibody (A19006) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of HeLa, using Caveolin-1 antibody (A19006) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Human colon using Caveolin-1 antibody (A19006) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human lung using Caveolin-1 antibody (A19006) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human Caveolin-1 (NP_001744.2). KO Validated Validated Isotype IgG