быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD11a/LFA-1A/ITGAL Rabbit mAb (A19009)
- Описание
- Характеристики
-
Overview
Product name CD11a/LFA-1A/ITGAL Rabbit mAb Catalog No. A19009 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0344 Background
ITGAL encodes the integrin alpha L chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form the integrin lymphocyte function-associated antigen-1 (LFA-1), which is expressed on all leukocytes. LFA-1 plays a central role in leukocyte intercellular adhesion through interactions with its ligands, ICAMs 1-3 (intercellular adhesion molecules 1 through 3), and also functions in lymphocyte costimulatory signaling. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1071-1170 of human CD11a/LFA-1A/ITGAL (P20701). Sequence NASLAQVVMKVDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAGRGVPNGIPAEDSEQLASGQEAGDPGCLKPLHEKDSESGGGKD Gene ID Swiss Prot Synonyms CD11A; LFA-1; LFA1A Calculated MW 129kDa Observed MW 180kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples THP-1 Cellular location Membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of THP-1 cells, using CD11a/LFA-1A/ITGAL antibody (A19009) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human spleen using CD11a/LFA-1A/ITGAL Rabbit mAb (A19009) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1071-1170 of human CD11a/LFA-1A/ITGAL (P20701). Isotype IgG