быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD11b/ITGAM Rabbit mAb (A19010)
- Описание
- Характеристики
-
Overview
Product name CD11b/ITGAM Rabbit mAb Catalog No. A19010 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0414 Background
This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ('Mac-1'), or inactivated-C3b (iC3b) receptor 3 ('CR3'). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1053-1152 of human CD11b/ITGAM (P11215). Sequence FDWYIKTSHNHLLIVSTAEILFNDSVFTLLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLLALITAALYKLGFFKRQYKDMMSEGGPPGAEPQ Gene ID Swiss Prot Synonyms CR3A; MO1A; CD11B; MAC-1; MAC1A; SLEB6 Calculated MW 127kDa Observed MW 170kDa Applications
Reactivity Human Tested applications WB IHC-P FC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- FC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Flow Cytometry Positive samples U-937 Cellular location Membrane, Single-pass type I membrane protein Customer validation WB(Rattus norvegicus, Mus musculus)
Immunohistochemistry analysis of paraffin-embedded human lung cancer using CD11b/ITGAM Rabbit mAb (A19010) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry, Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1053-1152 of human CD11b/ITGAM (P11215). Isotype IgG