быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD14 Rabbit mAb (A19011)
- Описание
- Характеристики
-
Overview
Product name CD14 Rabbit mAb Catalog No. A19011 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0353 Background
The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide, and to viruses. This gene has been identified as a target candidate in the treatment of SARS-CoV-2-infected patients to potentially lessen or inhibit a severe inflammatory response. Alternative splicing results in multiple transcript variants encoding the same protein.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CD14 (P08571). Sequence QPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVP Gene ID Swiss Prot Synonyms CD14 Calculated MW 40kDa Observed MW 50-65kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IF/ICC FC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- FC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Flow Cytometry Positive samples U-87MG, THP-1, A-549, RAW264.7 Cellular location Cell membrane, GPI-anchor, Lipid-anchor, Secreted Customer validation (293t nci-n87 ht29 )
IHC(Homo sapiens)
WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using CD14 antibody (A19011) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human lung cancer using CD14 Rabbit mAb (A19011) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of THP-1 cells using CD14 Rabbit mAb (A19011) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Flow cytometry:1X10^6 Jurkat cells (negative control, left) and A549 cells (right) were surface-stained with CD14 Rabbit mAb(A19011, 10 μg/mL, green line) or Rabbit IgG isotype control (AC042, 10 μg/mL, blue line), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb(1:600 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CD14 (P08571). Isotype IgG
